Anti SPINK2 pAb (ATL-HPA026813 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA026813-25

Protein Description: serine peptidase inhibitor, Kazal type 2 (acrosin-trypsin inhibitor)
Gene Name: SPINK2
Alternative Gene Name: HUSI-II
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053030: 62%, ENSRNOG00000047065: 58%
Entrez Gene ID: 6691
Uniprot ID: P20155
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC
• Gene Sequence: KYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC
• Gene ID - Mouse: ENSMUSG00000053030
• Gene ID - Rat: ENSRNOG00000047065
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SPINK2 pAb (ATL-HPA026813 w/enhanced validation) – 2 Found

Kherraf, Zine-Eddine; Christou-Kent, Marie; Karaouzene, Thomas; Amiri-Yekta, Amir; Martinez, Guillaume; Vargas, Alexandra S; Lambert, Emeline; Borel, Christelle; Dorphin, Béatrice; Aknin-Seifer, Isabelle; Mitchell, Michael J; Metzler-Guillemain, Catherine; Escoffier, Jessica; Nef, Serge; Grepillat, Mariane; Thierry-Mieg, Nicolas; Satre, Véronique; Bailly, Marc; Boitrelle, Florence; Pernet-Gallay, Karin; Hennebicq, Sylviane; Fauré, Julien; Bottari, Serge P; Coutton, Charles; Ray, Pierre F; Arnoult, Christophe. SPINK2 deficiency causes infertility by inducing sperm defects in heterozygotes and azoospermia in homozygotes. Embo Molecular Medicine. 2017;9(8):1132-1149. 

Calvanese, Vincenzo; Capellera-Garcia, Sandra; Ma, Feiyang; Fares, Iman; Liebscher, Simone; Ng, Elizabeth S; Ekstrand, Sophia; Aguadé-Gorgorió, Júlia; Vavilina, Anastasia; Lefaudeux, Diane; Nadel, Brian; Li, Jacky Y; Wang, Yanling; Lee, Lydia K; Ardehali, Reza; Iruela-Arispe, M Luisa; Pellegrini, Matteo; Stanley, Ed G; Elefanty, Andrew G; Schenke-Layland, Katja; Mikkola, Hanna K A. Mapping human haematopoietic stem cells from haemogenic endothelium to birth. Nature. 2022;604(7906):534-540.