Anti SPIN2A pAb (ATL-HPA069835)

Atlas Antibodies

SKU: ATL-HPA069835-25

• 

Protein Description: spindlin family, member 2A
Gene Name: SPIN2A
Alternative Gene Name: DXF34, SPIN2, TDRD25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021395: 53%, ENSRNOG00000011119: 53%
Entrez Gene ID: 54466
Uniprot ID: Q99865
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQ
• Gene Sequence: MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQ
• Gene ID - Mouse: ENSMUSG00000021395
• Gene ID - Rat: ENSRNOG00000011119
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.