Anti SPIN2A pAb (ATL-HPA069835)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069835-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SPIN2A
Alternative Gene Name: DXF34, SPIN2, TDRD25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021395: 53%, ENSRNOG00000011119: 53%
Entrez Gene ID: 54466
Uniprot ID: Q99865
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQ |
| Gene Sequence | MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQ |
| Gene ID - Mouse | ENSMUSG00000021395 |
| Gene ID - Rat | ENSRNOG00000011119 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SPIN2A pAb (ATL-HPA069835) | |
| Datasheet | Anti SPIN2A pAb (ATL-HPA069835) Datasheet (External Link) |
| Vendor Page | Anti SPIN2A pAb (ATL-HPA069835) at Atlas Antibodies |
| Documents & Links for Anti SPIN2A pAb (ATL-HPA069835) | |
| Datasheet | Anti SPIN2A pAb (ATL-HPA069835) Datasheet (External Link) |
| Vendor Page | Anti SPIN2A pAb (ATL-HPA069835) |