Anti SPIN1 pAb (ATL-HPA068784)

Atlas Antibodies

Catalog No.:
ATL-HPA068784-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: spindlin 1
Gene Name: SPIN1
Alternative Gene Name: SPIN, TDRD24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021395: 98%, ENSRNOG00000011119: 98%
Entrez Gene ID: 10927
Uniprot ID: Q9Y657
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNI
Gene Sequence MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNI
Gene ID - Mouse ENSMUSG00000021395
Gene ID - Rat ENSRNOG00000011119
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPIN1 pAb (ATL-HPA068784)
Datasheet Anti SPIN1 pAb (ATL-HPA068784) Datasheet (External Link)
Vendor Page Anti SPIN1 pAb (ATL-HPA068784) at Atlas Antibodies

Documents & Links for Anti SPIN1 pAb (ATL-HPA068784)
Datasheet Anti SPIN1 pAb (ATL-HPA068784) Datasheet (External Link)
Vendor Page Anti SPIN1 pAb (ATL-HPA068784)