Anti SPICE1 pAb (ATL-HPA064843 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA064843-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: spindle and centriole associated protein 1
Gene Name: SPICE1
Alternative Gene Name: CCDC52, SPICE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043065: 75%, ENSRNOG00000039024: 71%
Entrez Gene ID: 152185
Uniprot ID: Q8N0Z3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEQLISLTHAIKNCPVINNRQEIQASESGATGRRVMDSPERPVVNANVSVPLMFREEVAEFPQEELPVKLSQVP
Gene Sequence DEQLISLTHAIKNCPVINNRQEIQASESGATGRRVMDSPERPVVNANVSVPLMFREEVAEFPQEELPVKLSQVP
Gene ID - Mouse ENSMUSG00000043065
Gene ID - Rat ENSRNOG00000039024
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPICE1 pAb (ATL-HPA064843 w/enhanced validation)
Datasheet Anti SPICE1 pAb (ATL-HPA064843 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SPICE1 pAb (ATL-HPA064843 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SPICE1 pAb (ATL-HPA064843 w/enhanced validation)
Datasheet Anti SPICE1 pAb (ATL-HPA064843 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SPICE1 pAb (ATL-HPA064843 w/enhanced validation)
Citations for Anti SPICE1 pAb (ATL-HPA064843 w/enhanced validation) – 3 Found
Deretic, Jovana; Kerr, Alastair; Welburn, Julie P I. A rapid computational approach identifies SPICE1 as an Aurora kinase substrate. Molecular Biology Of The Cell. 2019;30(3):312-323.  PubMed
Sydor, Andrew Michael; Coyaud, Etienne; Rovelli, Cristina; Laurent, Estelle; Liu, Helen; Raught, Brian; Mennella, Vito. PPP1R35 is a novel centrosomal protein that regulates centriole length in concert with the microcephaly protein RTTN. Elife. 2018;7( 30168418)  PubMed
Balestra, Fernando R; Domínguez-Calvo, Andrés; Wolf, Benita; Busso, Coralie; Buff, Alizée; Averink, Tessa; Lipsanen-Nyman, Marita; Huertas, Pablo; Ríos, Rosa M; Gönczy, Pierre. TRIM37 prevents formation of centriolar protein assemblies by regulating Centrobin. Elife. 2021;10( 33491649)  PubMed