Anti SPDYE1 pAb (ATL-HPA051750)

Atlas Antibodies

Catalog No.: ATL-HPA051750-100

Protein Description: speedy/RINGO cell cycle regulator family member E1
Gene Name: SPDYE1
Alternative Gene Name: Ringo1, SPDYE, WBSCR19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039296: 73%, ENSRNOG00000058563: 75%
Entrez Gene ID: 285955
Uniprot ID: Q8NFV5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAM
• Gene Sequence: SLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAM
• Gene ID - Mouse: ENSMUSG00000039296
• Gene ID - Rat: ENSRNOG00000058563
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.