Anti SPDYA pAb (ATL-HPA066214 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA066214-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: speedy/RINGO cell cycle regulator family member A
Gene Name: SPDYA
Alternative Gene Name: Ringo3, SPDY1, SPY1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052525: 97%, ENSRNOG00000004534: 94%
Entrez Gene ID: 245711
Uniprot ID: Q5MJ70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSS
Gene Sequence CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSS
Gene ID - Mouse ENSMUSG00000052525
Gene ID - Rat ENSRNOG00000004534
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPDYA pAb (ATL-HPA066214 w/enhanced validation)
Datasheet Anti SPDYA pAb (ATL-HPA066214 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SPDYA pAb (ATL-HPA066214 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SPDYA pAb (ATL-HPA066214 w/enhanced validation)
Datasheet Anti SPDYA pAb (ATL-HPA066214 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SPDYA pAb (ATL-HPA066214 w/enhanced validation)