Anti SPDYA pAb (ATL-HPA066214 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA066214-25

• 

Protein Description: speedy/RINGO cell cycle regulator family member A
Gene Name: SPDYA
Alternative Gene Name: Ringo3, SPDY1, SPY1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052525: 97%, ENSRNOG00000004534: 94%
Entrez Gene ID: 245711
Uniprot ID: Q5MJ70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSS
• Gene Sequence: CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSS
• Gene ID - Mouse: ENSMUSG00000052525
• Gene ID - Rat: ENSRNOG00000004534
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.