Anti SPDEF pAb (ATL-HPA055707)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055707-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: SPDEF
Alternative Gene Name: bA375E1.3, PDEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024215: 79%, ENSRNOG00000000491: 79%
Entrez Gene ID: 25803
Uniprot ID: O95238
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKW |
Gene Sequence | QCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKW |
Gene ID - Mouse | ENSMUSG00000024215 |
Gene ID - Rat | ENSRNOG00000000491 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SPDEF pAb (ATL-HPA055707) | |
Datasheet | Anti SPDEF pAb (ATL-HPA055707) Datasheet (External Link) |
Vendor Page | Anti SPDEF pAb (ATL-HPA055707) at Atlas Antibodies |
Documents & Links for Anti SPDEF pAb (ATL-HPA055707) | |
Datasheet | Anti SPDEF pAb (ATL-HPA055707) Datasheet (External Link) |
Vendor Page | Anti SPDEF pAb (ATL-HPA055707) |