Anti SPDEF pAb (ATL-HPA055707)

Atlas Antibodies

Catalog No.:
ATL-HPA055707-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: SAM pointed domain containing ETS transcription factor
Gene Name: SPDEF
Alternative Gene Name: bA375E1.3, PDEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024215: 79%, ENSRNOG00000000491: 79%
Entrez Gene ID: 25803
Uniprot ID: O95238
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKW
Gene Sequence QCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKW
Gene ID - Mouse ENSMUSG00000024215
Gene ID - Rat ENSRNOG00000000491
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPDEF pAb (ATL-HPA055707)
Datasheet Anti SPDEF pAb (ATL-HPA055707) Datasheet (External Link)
Vendor Page Anti SPDEF pAb (ATL-HPA055707) at Atlas Antibodies

Documents & Links for Anti SPDEF pAb (ATL-HPA055707)
Datasheet Anti SPDEF pAb (ATL-HPA055707) Datasheet (External Link)
Vendor Page Anti SPDEF pAb (ATL-HPA055707)