Anti SPATS2 pAb (ATL-HPA066105)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066105-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SPATS2
Alternative Gene Name: FLJ13117, SCR59, SPATA10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051934: 73%, ENSRNOG00000052307: 69%
Entrez Gene ID: 65244
Uniprot ID: Q86XZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SGSRYQSAPSQAPGNTIERGQTHSAGTNGTGVSMEPSPPTPSFKKGLPQRKPRTSQTEAVNS |
| Gene Sequence | SGSRYQSAPSQAPGNTIERGQTHSAGTNGTGVSMEPSPPTPSFKKGLPQRKPRTSQTEAVNS |
| Gene ID - Mouse | ENSMUSG00000051934 |
| Gene ID - Rat | ENSRNOG00000052307 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SPATS2 pAb (ATL-HPA066105) | |
| Datasheet | Anti SPATS2 pAb (ATL-HPA066105) Datasheet (External Link) |
| Vendor Page | Anti SPATS2 pAb (ATL-HPA066105) at Atlas Antibodies |
| Documents & Links for Anti SPATS2 pAb (ATL-HPA066105) | |
| Datasheet | Anti SPATS2 pAb (ATL-HPA066105) Datasheet (External Link) |
| Vendor Page | Anti SPATS2 pAb (ATL-HPA066105) |