Anti SPATS2 pAb (ATL-HPA066105)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066105-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SPATS2
Alternative Gene Name: FLJ13117, SCR59, SPATA10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051934: 73%, ENSRNOG00000052307: 69%
Entrez Gene ID: 65244
Uniprot ID: Q86XZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SGSRYQSAPSQAPGNTIERGQTHSAGTNGTGVSMEPSPPTPSFKKGLPQRKPRTSQTEAVNS |
Gene Sequence | SGSRYQSAPSQAPGNTIERGQTHSAGTNGTGVSMEPSPPTPSFKKGLPQRKPRTSQTEAVNS |
Gene ID - Mouse | ENSMUSG00000051934 |
Gene ID - Rat | ENSRNOG00000052307 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SPATS2 pAb (ATL-HPA066105) | |
Datasheet | Anti SPATS2 pAb (ATL-HPA066105) Datasheet (External Link) |
Vendor Page | Anti SPATS2 pAb (ATL-HPA066105) at Atlas Antibodies |
Documents & Links for Anti SPATS2 pAb (ATL-HPA066105) | |
Datasheet | Anti SPATS2 pAb (ATL-HPA066105) Datasheet (External Link) |
Vendor Page | Anti SPATS2 pAb (ATL-HPA066105) |