Anti SPATC1L pAb (ATL-HPA029394)

Atlas Antibodies

Catalog No.: ATL-HPA029394-25

Protein Description: spermatogenesis and centriole associated 1-like
Gene Name: SPATC1L
Alternative Gene Name: C21orf56
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009115: 77%, ENSRNOG00000045929: 77%
Entrez Gene ID: 84221
Uniprot ID: Q9H0A9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NADLKKQVRLLKENQMLRRLLSQSCQEGGGHDLLPPRAHAYPEAGSPGSGVPDFGRFTSVADTPSQLQTSSLEDLLCSHAPLSSEDD
• Gene Sequence: NADLKKQVRLLKENQMLRRLLSQSCQEGGGHDLLPPRAHAYPEAGSPGSGVPDFGRFTSVADTPSQLQTSSLEDLLCSHAPLSSEDD
• Gene ID - Mouse: ENSMUSG00000009115
• Gene ID - Rat: ENSRNOG00000045929
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.