Anti SPATA9 pAb (ATL-HPA076967)

Atlas Antibodies

Catalog No.:
ATL-HPA076967-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: spermatogenesis associated 9
Gene Name: SPATA9
Alternative Gene Name: FLJ35906, NYD-SP16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021590: 77%, ENSRNOG00000012770: 76%
Entrez Gene ID: 83890
Uniprot ID: Q9BWV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKINRATLIRG
Gene Sequence MPIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKINRATLIRG
Gene ID - Mouse ENSMUSG00000021590
Gene ID - Rat ENSRNOG00000012770
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPATA9 pAb (ATL-HPA076967)
Datasheet Anti SPATA9 pAb (ATL-HPA076967) Datasheet (External Link)
Vendor Page Anti SPATA9 pAb (ATL-HPA076967) at Atlas Antibodies

Documents & Links for Anti SPATA9 pAb (ATL-HPA076967)
Datasheet Anti SPATA9 pAb (ATL-HPA076967) Datasheet (External Link)
Vendor Page Anti SPATA9 pAb (ATL-HPA076967)