Anti SPATA9 pAb (ATL-HPA010848 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA010848-25

Protein Description: spermatogenesis associated 9
Gene Name: SPATA9
Alternative Gene Name: FLJ35906, NYD-SP16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021590: 77%, ENSRNOG00000012770: 81%
Entrez Gene ID: 83890
Uniprot ID: Q9BWV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKKVKNIFQEEESIRQNREESENCRKAFSEPVLSEPMFAEGEIKAKPYRSLPEKPDISDYPKLLANKQSNNIQVLHSVFDQSAEMNEQI
• Gene Sequence: LKKVKNIFQEEESIRQNREESENCRKAFSEPVLSEPMFAEGEIKAKPYRSLPEKPDISDYPKLLANKQSNNIQVLHSVFDQSAEMNEQI
• Gene ID - Mouse: ENSMUSG00000021590
• Gene ID - Rat: ENSRNOG00000012770
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.