Anti SPATA4 pAb (ATL-HPA019220 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019220-25

Protein Description: spermatogenesis associated 4
Gene Name: SPATA4
Alternative Gene Name: SPEF1B, TSARG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031518: 47%, ENSRNOG00000048035: 55%
Entrez Gene ID: 132851
Uniprot ID: Q8NEY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LILLHMLQRKLGRKLNPEWFDVKPTVGEVTLNHLPAQASGRRYNLKVKRGRVVPVLPNIGSGGSSHREIHVKQAGQHSYYSAMKPIRN
• Gene Sequence: LILLHMLQRKLGRKLNPEWFDVKPTVGEVTLNHLPAQASGRRYNLKVKRGRVVPVLPNIGSGGSSHREIHVKQAGQHSYYSAMKPIRN
• Gene ID - Mouse: ENSMUSG00000031518
• Gene ID - Rat: ENSRNOG00000048035
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.