Anti SPATA33 pAb (ATL-HPA073096)

Atlas Antibodies

Catalog No.:
ATL-HPA073096-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: spermatogenesis associated 33
Gene Name: SPATA33
Alternative Gene Name: C16orf55, FLJ31606
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048478: 55%, ENSRNOG00000038239: 53%
Entrez Gene ID: 124045
Uniprot ID: Q96N06
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SCSSSGSDQQRTIREPEDWGPYRRHRNPSTADAYNSHLKE
Gene Sequence SCSSSGSDQQRTIREPEDWGPYRRHRNPSTADAYNSHLKE
Gene ID - Mouse ENSMUSG00000048478
Gene ID - Rat ENSRNOG00000038239
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPATA33 pAb (ATL-HPA073096)
Datasheet Anti SPATA33 pAb (ATL-HPA073096) Datasheet (External Link)
Vendor Page Anti SPATA33 pAb (ATL-HPA073096) at Atlas Antibodies

Documents & Links for Anti SPATA33 pAb (ATL-HPA073096)
Datasheet Anti SPATA33 pAb (ATL-HPA073096) Datasheet (External Link)
Vendor Page Anti SPATA33 pAb (ATL-HPA073096)