Anti SPATA33 pAb (ATL-HPA045648 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA045648-25

• 
• 

Protein Description: spermatogenesis associated 33
Gene Name: SPATA33
Alternative Gene Name: C16orf55, FLJ31606
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048478: 51%, ENSRNOG00000038239: 49%
Entrez Gene ID: 124045
Uniprot ID: Q96N06
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVPKSKEKLMEKHSQEARQADRESEKPVDSLHPGAGTAKHPPPAASLEEKPDVKQKSSRKK
• Gene Sequence: SVPKSKEKLMEKHSQEARQADRESEKPVDSLHPGAGTAKHPPPAASLEEKPDVKQKSSRKK
• Gene ID - Mouse: ENSMUSG00000048478
• Gene ID - Rat: ENSRNOG00000038239
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.