Anti SPATA2 pAb (ATL-HPA048581)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048581-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SPATA2
Alternative Gene Name: KIAA0757, PD1, PPP1R145, tamo
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047030: 88%, ENSRNOG00000009207: 85%
Entrez Gene ID: 9825
Uniprot ID: Q9UM82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TYFSTQDDVDLYTDSEPRATYRRQDALRPDVWLLRNDAHSLYHKRSPPAKESALSKCQSCGLSCSSSLCQRCDSLLTCPPAS |
| Gene Sequence | TYFSTQDDVDLYTDSEPRATYRRQDALRPDVWLLRNDAHSLYHKRSPPAKESALSKCQSCGLSCSSSLCQRCDSLLTCPPAS |
| Gene ID - Mouse | ENSMUSG00000047030 |
| Gene ID - Rat | ENSRNOG00000009207 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SPATA2 pAb (ATL-HPA048581) | |
| Datasheet | Anti SPATA2 pAb (ATL-HPA048581) Datasheet (External Link) |
| Vendor Page | Anti SPATA2 pAb (ATL-HPA048581) at Atlas Antibodies |
| Documents & Links for Anti SPATA2 pAb (ATL-HPA048581) | |
| Datasheet | Anti SPATA2 pAb (ATL-HPA048581) Datasheet (External Link) |
| Vendor Page | Anti SPATA2 pAb (ATL-HPA048581) |
| Citations for Anti SPATA2 pAb (ATL-HPA048581) – 2 Found |
| Wieser, Verena; Sprung, Susanne; Tsibulak, Irina; Haybaeck, Johannes; Hackl, Hubert; Fiegl, Heidelinde; Marth, Christian; Zeimet, Alain Gustave. Clinical Impact of RANK Signalling in Ovarian Cancer. Cancers. 2019;11(6) PubMed |
| Wieser, Verena; Tsibulak, Irina; Degasper, Christine; Welponer, Hannah; Leitner, Katharina; Parson, Walther; Zeimet, Alain G; Marth, Christian; Fiegl, Heidelinde. Tumor necrosis factor receptor modulator spermatogenesis-associated protein 2 is a novel predictor of outcome in ovarian cancer. Cancer Science. 2019;110(3):1117-1126. PubMed |