Anti SPATA17 pAb (ATL-HPA030099 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA030099-25

Protein Description: spermatogenesis associated 17
Gene Name: SPATA17
Alternative Gene Name: IQCH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026611: 71%, ENSRNOG00000002504: 73%
Entrez Gene ID: 128153
Uniprot ID: Q96L03
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEPDPWELQLQKAKPLTHRRPKVKQKDSTSLTDWLACTSARSFPRSEILPPINRKQCQGPFRDITEVLEQRYRPLEPTLRVAEPIDEL
• Gene Sequence: KEPDPWELQLQKAKPLTHRRPKVKQKDSTSLTDWLACTSARSFPRSEILPPINRKQCQGPFRDITEVLEQRYRPLEPTLRVAEPIDEL
• Gene ID - Mouse: ENSMUSG00000026611
• Gene ID - Rat: ENSRNOG00000002504
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.