Anti SPARC pAb (ATL-HPA003020 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003020-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SPARC
Alternative Gene Name: ON
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018593: 86%, ENSRNOG00000012840: 85%
Entrez Gene ID: 6678
Uniprot ID: P09486
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDY |
| Gene Sequence | QEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDY |
| Gene ID - Mouse | ENSMUSG00000018593 |
| Gene ID - Rat | ENSRNOG00000012840 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SPARC pAb (ATL-HPA003020 w/enhanced validation) | |
| Datasheet | Anti SPARC pAb (ATL-HPA003020 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SPARC pAb (ATL-HPA003020 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SPARC pAb (ATL-HPA003020 w/enhanced validation) | |
| Datasheet | Anti SPARC pAb (ATL-HPA003020 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SPARC pAb (ATL-HPA003020 w/enhanced validation) |
| Citations for Anti SPARC pAb (ATL-HPA003020 w/enhanced validation) – 3 Found |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |
| Pan, Zhenguo; Xie, Rui; Song, Wei; Gao, Chengcheng. MicroRNA‑592 promotes cell proliferation, migration and invasion in colorectal cancer by directly targeting SPARC. Molecular Medicine Reports. 2021;23(4) PubMed |
| Kuriyama, Sei; Tanaka, Gentaro; Takagane, Kurara; Itoh, Go; Tanaka, Masamitsu. Pigment Epithelium Derived Factor Is Involved in the Late Phase of Osteosarcoma Metastasis by Increasing Extravasation and Cell-Cell Adhesion. Frontiers In Oncology. 12( 35174090):818182. PubMed |