Anti SPARC pAb (ATL-HPA003020 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003020-25

Protein Description: secreted protein, acidic, cysteine-rich (osteonectin)
Gene Name: SPARC
Alternative Gene Name: ON
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018593: 86%, ENSRNOG00000012840: 85%
Entrez Gene ID: 6678
Uniprot ID: P09486
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDY
• Gene Sequence: QEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDY
• Gene ID - Mouse: ENSMUSG00000018593
• Gene ID - Rat: ENSRNOG00000012840
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SPARC pAb (ATL-HPA003020 w/enhanced validation) – 3 Found

Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. 

Pan, Zhenguo; Xie, Rui; Song, Wei; Gao, Chengcheng. MicroRNA‑592 promotes cell proliferation, migration and invasion in colorectal cancer by directly targeting SPARC. Molecular Medicine Reports. 2021;23(4) 

Kuriyama, Sei; Tanaka, Gentaro; Takagane, Kurara; Itoh, Go; Tanaka, Masamitsu. Pigment Epithelium Derived Factor Is Involved in the Late Phase of Osteosarcoma Metastasis by Increasing Extravasation and Cell-Cell Adhesion. Frontiers In Oncology. 12( 35174090):818182.