Anti SPANXN4 pAb (ATL-HPA059094)

Atlas Antibodies

Catalog No.:
ATL-HPA059094-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: SPANX family member N4
Gene Name: SPANXN4
Alternative Gene Name: CT11.9, SPANX-N4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059395: 28%, ENSRNOG00000049817: 31%
Entrez Gene ID: 441525
Uniprot ID: Q5MJ08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTSSTNENKMKSPCESNKRKVDKKKKNLHRASAPEQSLKETEKAKYPTLVFYCRKNKKRN
Gene Sequence PTSSTNENKMKSPCESNKRKVDKKKKNLHRASAPEQSLKETEKAKYPTLVFYCRKNKKRN
Gene ID - Mouse ENSMUSG00000059395
Gene ID - Rat ENSRNOG00000049817
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPANXN4 pAb (ATL-HPA059094)
Datasheet Anti SPANXN4 pAb (ATL-HPA059094) Datasheet (External Link)
Vendor Page Anti SPANXN4 pAb (ATL-HPA059094) at Atlas Antibodies

Documents & Links for Anti SPANXN4 pAb (ATL-HPA059094)
Datasheet Anti SPANXN4 pAb (ATL-HPA059094) Datasheet (External Link)
Vendor Page Anti SPANXN4 pAb (ATL-HPA059094)