Anti SPAG9 pAb (ATL-HPA061458)

Atlas Antibodies

SKU: ATL-HPA061458-25

• 

Protein Description: sperm associated antigen 9
Gene Name: SPAG9
Alternative Gene Name: CT89, FLJ13450, FLJ14006, FLJ26141, FLJ34602, HLC4, HSS, JLP, KIAA0516, MGC117291, MGC14967, MGC74461, PHET, PIG6, SYD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020859: 94%, ENSRNOG00000002749: 91%
Entrez Gene ID: 9043
Uniprot ID: O60271
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLSGGKTRDGGSVVGASVFYKDVAGLDTEGSKQRSASQSSLDKLDQELKEQQKELKNQEELSSLVWICTSTHSATKVL
• Gene Sequence: NLSGGKTRDGGSVVGASVFYKDVAGLDTEGSKQRSASQSSLDKLDQELKEQQKELKNQEELSSLVWICTSTHSATKVL
• Gene ID - Mouse: ENSMUSG00000020859
• Gene ID - Rat: ENSRNOG00000002749
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.