Anti SPAG4 pAb (ATL-HPA048393)

Atlas Antibodies

Catalog No.:
ATL-HPA048393-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: sperm associated antigen 4
Gene Name: SPAG4
Alternative Gene Name: CT127, SUN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038180: 89%, ENSRNOG00000048056: 89%
Entrez Gene ID: 6676
Uniprot ID: Q9NPE6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLENEPKEMLTLSEYHERVRSQGQQLQQLQAELDKLHKEVSTVRAANSERVAKLVFQRLNEDFVRKPDYALSSVGASIDLQKTSHDYAD
Gene Sequence PLENEPKEMLTLSEYHERVRSQGQQLQQLQAELDKLHKEVSTVRAANSERVAKLVFQRLNEDFVRKPDYALSSVGASIDLQKTSHDYAD
Gene ID - Mouse ENSMUSG00000038180
Gene ID - Rat ENSRNOG00000048056
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPAG4 pAb (ATL-HPA048393)
Datasheet Anti SPAG4 pAb (ATL-HPA048393) Datasheet (External Link)
Vendor Page Anti SPAG4 pAb (ATL-HPA048393) at Atlas Antibodies

Documents & Links for Anti SPAG4 pAb (ATL-HPA048393)
Datasheet Anti SPAG4 pAb (ATL-HPA048393) Datasheet (External Link)
Vendor Page Anti SPAG4 pAb (ATL-HPA048393)