Anti SPAG4 pAb (ATL-HPA048393)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048393-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SPAG4
Alternative Gene Name: CT127, SUN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038180: 89%, ENSRNOG00000048056: 89%
Entrez Gene ID: 6676
Uniprot ID: Q9NPE6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PLENEPKEMLTLSEYHERVRSQGQQLQQLQAELDKLHKEVSTVRAANSERVAKLVFQRLNEDFVRKPDYALSSVGASIDLQKTSHDYAD |
| Gene Sequence | PLENEPKEMLTLSEYHERVRSQGQQLQQLQAELDKLHKEVSTVRAANSERVAKLVFQRLNEDFVRKPDYALSSVGASIDLQKTSHDYAD |
| Gene ID - Mouse | ENSMUSG00000038180 |
| Gene ID - Rat | ENSRNOG00000048056 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SPAG4 pAb (ATL-HPA048393) | |
| Datasheet | Anti SPAG4 pAb (ATL-HPA048393) Datasheet (External Link) |
| Vendor Page | Anti SPAG4 pAb (ATL-HPA048393) at Atlas Antibodies |
| Documents & Links for Anti SPAG4 pAb (ATL-HPA048393) | |
| Datasheet | Anti SPAG4 pAb (ATL-HPA048393) Datasheet (External Link) |
| Vendor Page | Anti SPAG4 pAb (ATL-HPA048393) |