Anti SPACA9 pAb (ATL-HPA022243 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022243-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SPACA9
Alternative Gene Name: C9orf9, Mast
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026809: 89%, ENSRNOG00000012697: 93%
Entrez Gene ID: 11092
Uniprot ID: Q96E40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MNEVKESLRSIEQKYKLFQQQQLTFTAALEHCRENAHDKIRPISSIGQVQSYMEHYCNSSTDRRVLLMFLDICSELNKLCQHFE |
| Gene Sequence | MNEVKESLRSIEQKYKLFQQQQLTFTAALEHCRENAHDKIRPISSIGQVQSYMEHYCNSSTDRRVLLMFLDICSELNKLCQHFE |
| Gene ID - Mouse | ENSMUSG00000026809 |
| Gene ID - Rat | ENSRNOG00000012697 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SPACA9 pAb (ATL-HPA022243 w/enhanced validation) | |
| Datasheet | Anti SPACA9 pAb (ATL-HPA022243 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SPACA9 pAb (ATL-HPA022243 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SPACA9 pAb (ATL-HPA022243 w/enhanced validation) | |
| Datasheet | Anti SPACA9 pAb (ATL-HPA022243 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SPACA9 pAb (ATL-HPA022243 w/enhanced validation) |
| Citations for Anti SPACA9 pAb (ATL-HPA022243 w/enhanced validation) – 1 Found |
| Chen, Erfei; Yang, Fangfang; Li, Qiqi; Li, Tong; Yao, Danni; Cao, Lichao; Yang, Jin. Loss of Tumor Suppressor C9orf9 Promotes Metastasis in Colorectal Cancer. Biomolecules. 2023;13(2) PubMed |