Anti SPACA5B pAb (ATL-HPA044747)

Atlas Antibodies

Catalog No.:
ATL-HPA044747-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: sperm acrosome associated 5B
Gene Name: SPACA5B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037167: 89%, ENSRNOG00000045622: 90%
Entrez Gene ID: 729201
Uniprot ID: Q96QH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AGLNGYKGYGVGDWLCMAHYESGFDTAFVDHNPDGSSEYGIFQLNSAWWCDNGITPTKNLC
Gene Sequence AGLNGYKGYGVGDWLCMAHYESGFDTAFVDHNPDGSSEYGIFQLNSAWWCDNGITPTKNLC
Gene ID - Mouse ENSMUSG00000037167
Gene ID - Rat ENSRNOG00000045622
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPACA5B pAb (ATL-HPA044747)
Datasheet Anti SPACA5B pAb (ATL-HPA044747) Datasheet (External Link)
Vendor Page Anti SPACA5B pAb (ATL-HPA044747) at Atlas Antibodies

Documents & Links for Anti SPACA5B pAb (ATL-HPA044747)
Datasheet Anti SPACA5B pAb (ATL-HPA044747) Datasheet (External Link)
Vendor Page Anti SPACA5B pAb (ATL-HPA044747)