Anti SPACA5 pAb (ATL-HPA047149)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047149-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SPACA5
Alternative Gene Name: dJ54B20.3, LYC5, LYZL5, PNPK6288, SLLP2, UNQ6288
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037167: 63%, ENSRNOG00000045622: 68%
Entrez Gene ID: 389852
Uniprot ID: Q96QH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MDCHDLLNRHILDDIRCAKQIVSSQNGLSAWTSWRLHC |
| Gene Sequence | MDCHDLLNRHILDDIRCAKQIVSSQNGLSAWTSWRLHC |
| Gene ID - Mouse | ENSMUSG00000037167 |
| Gene ID - Rat | ENSRNOG00000045622 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SPACA5 pAb (ATL-HPA047149) | |
| Datasheet | Anti SPACA5 pAb (ATL-HPA047149) Datasheet (External Link) |
| Vendor Page | Anti SPACA5 pAb (ATL-HPA047149) at Atlas Antibodies |
| Documents & Links for Anti SPACA5 pAb (ATL-HPA047149) | |
| Datasheet | Anti SPACA5 pAb (ATL-HPA047149) Datasheet (External Link) |
| Vendor Page | Anti SPACA5 pAb (ATL-HPA047149) |