Anti SPACA1 pAb (ATL-HPA026744 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA026744-25

Protein Description: sperm acrosome associated 1
Gene Name: SPACA1
Alternative Gene Name: SAMP32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028264: 85%, ENSRNOG00000008232: 89%
Entrez Gene ID: 81833
Uniprot ID: Q9HBV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: REVILTNGCPGGESKCVVRVEECRGPTDCGWGKPISESLESVRLACIHTSPLNRFKYMWKL
• Gene Sequence: REVILTNGCPGGESKCVVRVEECRGPTDCGWGKPISESLESVRLACIHTSPLNRFKYMWKL
• Gene ID - Mouse: ENSMUSG00000028264
• Gene ID - Rat: ENSRNOG00000008232
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SPACA1 pAb (ATL-HPA026744 w/enhanced validation) – 2 Found

Longepied, Guy; Saut, Noemie; Aknin-Seifer, Isabelle; Levy, Rachel; Frances, Anne-Marie; Metzler-Guillemain, Catherine; Guichaoua, Marie-Roberte; Mitchell, Michael J. Complete deletion of the AZFb interval from the Y chromosome in an oligozoospermic man. Human Reproduction (Oxford, England). 2010;25(10):2655-63. 

Streichemberger, Eric; Perrin, Jeanne; Saias-Magnan, Jacqueline; Karsenty, Gilles; Malzac, Perrine; Grillo, Jean-Marie; Mitchell, Michael J; Metzler-Guillemain, Catherine. Case report of apoptosis in testis of four AZFc-deleted patients: increased DNA fragmentation during meiosis, but decreased apoptotic markers in post-meiotic germ cells. Human Reproduction (Oxford, England). 2012;27(7):1939-45.