Anti SPACA1 pAb (ATL-HPA026744 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026744-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SPACA1
Alternative Gene Name: SAMP32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028264: 85%, ENSRNOG00000008232: 89%
Entrez Gene ID: 81833
Uniprot ID: Q9HBV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | REVILTNGCPGGESKCVVRVEECRGPTDCGWGKPISESLESVRLACIHTSPLNRFKYMWKL |
| Gene Sequence | REVILTNGCPGGESKCVVRVEECRGPTDCGWGKPISESLESVRLACIHTSPLNRFKYMWKL |
| Gene ID - Mouse | ENSMUSG00000028264 |
| Gene ID - Rat | ENSRNOG00000008232 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SPACA1 pAb (ATL-HPA026744 w/enhanced validation) | |
| Datasheet | Anti SPACA1 pAb (ATL-HPA026744 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SPACA1 pAb (ATL-HPA026744 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SPACA1 pAb (ATL-HPA026744 w/enhanced validation) | |
| Datasheet | Anti SPACA1 pAb (ATL-HPA026744 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SPACA1 pAb (ATL-HPA026744 w/enhanced validation) |
| Citations for Anti SPACA1 pAb (ATL-HPA026744 w/enhanced validation) – 2 Found |
| Longepied, Guy; Saut, Noemie; Aknin-Seifer, Isabelle; Levy, Rachel; Frances, Anne-Marie; Metzler-Guillemain, Catherine; Guichaoua, Marie-Roberte; Mitchell, Michael J. Complete deletion of the AZFb interval from the Y chromosome in an oligozoospermic man. Human Reproduction (Oxford, England). 2010;25(10):2655-63. PubMed |
| Streichemberger, Eric; Perrin, Jeanne; Saias-Magnan, Jacqueline; Karsenty, Gilles; Malzac, Perrine; Grillo, Jean-Marie; Mitchell, Michael J; Metzler-Guillemain, Catherine. Case report of apoptosis in testis of four AZFc-deleted patients: increased DNA fragmentation during meiosis, but decreased apoptotic markers in post-meiotic germ cells. Human Reproduction (Oxford, England). 2012;27(7):1939-45. PubMed |