Anti SP7 pAb (ATL-HPA063202)

Atlas Antibodies

Catalog No.:
ATL-HPA063202-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Sp7 transcription factor
Gene Name: SP7
Alternative Gene Name: osterix, OSX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060284: 99%, ENSRNOG00000014082: 99%
Entrez Gene ID: 121340
Uniprot ID: Q8TDD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QGQGDGLQGTLPTGPAQPPLNPQLPTYPSDFAPLNPAPYPAPHLLQPGPQHVLPQDVYKPKAVGNSG
Gene Sequence QGQGDGLQGTLPTGPAQPPLNPQLPTYPSDFAPLNPAPYPAPHLLQPGPQHVLPQDVYKPKAVGNSG
Gene ID - Mouse ENSMUSG00000060284
Gene ID - Rat ENSRNOG00000014082
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SP7 pAb (ATL-HPA063202)
Datasheet Anti SP7 pAb (ATL-HPA063202) Datasheet (External Link)
Vendor Page Anti SP7 pAb (ATL-HPA063202) at Atlas Antibodies

Documents & Links for Anti SP7 pAb (ATL-HPA063202)
Datasheet Anti SP7 pAb (ATL-HPA063202) Datasheet (External Link)
Vendor Page Anti SP7 pAb (ATL-HPA063202)