Anti SP4 pAb (ATL-HPA040395)

Atlas Antibodies

Catalog No.:
ATL-HPA040395-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Sp4 transcription factor
Gene Name: SP4
Alternative Gene Name: HF1B, MGC130008, MGC130009, SPR-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025323: 100%, ENSRNOG00000005472: 100%
Entrez Gene ID: 6671
Uniprot ID: Q02446
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NQATGQQQIIIDPSQGLVQLQNQPQQLELVTTQLAGNAWQLVASTPPASKENNVSQP
Gene Sequence NQATGQQQIIIDPSQGLVQLQNQPQQLELVTTQLAGNAWQLVASTPPASKENNVSQP
Gene ID - Mouse ENSMUSG00000025323
Gene ID - Rat ENSRNOG00000005472
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SP4 pAb (ATL-HPA040395)
Datasheet Anti SP4 pAb (ATL-HPA040395) Datasheet (External Link)
Vendor Page Anti SP4 pAb (ATL-HPA040395) at Atlas Antibodies

Documents & Links for Anti SP4 pAb (ATL-HPA040395)
Datasheet Anti SP4 pAb (ATL-HPA040395) Datasheet (External Link)
Vendor Page Anti SP4 pAb (ATL-HPA040395)