Anti SP140 pAb (ATL-HPA067493 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA067493-25

• 
• 

Protein Description: SP140 nuclear body protein
Gene Name: SP140
Alternative Gene Name: LYSP100-A, LYSP100-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033964: 30%, ENSRNOG00000021116: 33%
Entrez Gene ID: 11262
Uniprot ID: Q13342
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSLLPGEGEEGSDDCSEMCDGEERQEASSSLARRGSVSSELENHPMNEEGESEELASSLLYDNVPGAEQSA
• Gene Sequence: LSLLPGEGEEGSDDCSEMCDGEERQEASSSLARRGSVSSELENHPMNEEGESEELASSLLYDNVPGAEQSA
• Gene ID - Mouse: ENSMUSG00000033964
• Gene ID - Rat: ENSRNOG00000021116
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.