Anti SP140 pAb (ATL-HPA006162 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA006162-25

Protein Description: SP140 nuclear body protein
Gene Name: SP140
Alternative Gene Name: LYSP100-A, LYSP100-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079808: 30%, ENSRNOG00000022800: 32%
Entrez Gene ID: 11262
Uniprot ID: Q13342
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SELEKTFGWSHLEALFSRINLMAYPDLNEIYRSFQNVCYEHSPLQMNNVNDLEDRPRLLPYGKQENSNACHEMDDIAVPQEALSSSPRCEPGFSSESCEQLALPKAGGGDAEDAPSLLPGGGVSCKLAIQIDEGESEEMPKLLP
• Gene Sequence: SELEKTFGWSHLEALFSRINLMAYPDLNEIYRSFQNVCYEHSPLQMNNVNDLEDRPRLLPYGKQENSNACHEMDDIAVPQEALSSSPRCEPGFSSESCEQLALPKAGGGDAEDAPSLLPGGGVSCKLAIQIDEGESEEMPKLLP
• Gene ID - Mouse: ENSMUSG00000079808
• Gene ID - Rat: ENSRNOG00000022800
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SP140 pAb (ATL-HPA006162 w/enhanced validation) – 2 Found

Mehta, Stuti; Cronkite, D Alexander; Basavappa, Megha; Saunders, Tahnee L; Adiliaghdam, Fatemeh; Amatullah, Hajera; Morrison, Sara A; Pagan, Jose D; Anthony, Robert M; Tonnerre, Pierre; Lauer, Georg M; Lee, James C; Digumarthi, Sreehaas; Pantano, Lorena; Ho Sui, Shannan J; Ji, Fei; Sadreyev, Ruslan; Zhou, Chan; Mullen, Alan C; Kumar, Vinod; Li, Yang; Wijmenga, Cisca; Xavier, Ramnik J; Means, Terry K; Jeffrey, Kate L. Maintenance of macrophage transcriptional programs and intestinal homeostasis by epigenetic reader SP140. Science Immunology. 2017;2(9) 

Ghiboub, Mohammed; Koster, Jan; Craggs, Peter D; Li Yim, Andrew Y F; Shillings, Anthony; Hutchinson, Sue; Bingham, Ryan P; Gatfield, Kelly; Hageman, Ishtu L; Yao, Gang; O'Keefe, Heather P; Coffin, Aaron; Patel, Amish; Sloan, Lisa A; Mitchell, Darren J; Hayhow, Thomas G; Lunven, Laurent; Watson, Robert J; Blunt, Christopher E; Harrison, Lee A; Bruton, Gordon; Kumar, Umesh; Hamer, Natalie; Spaull, John R; Zwijnenburg, Danny A; Welting, Olaf; Hakvoort, Theodorus B M; Te Velde, Anje A; van Limbergen, Johan; Henneman, Peter; Prinjha, Rab K; de Winther, Menno P J; Harker, Nicola R; Tough, David F; de Jonge, Wouter J. Modulation of macrophage inflammatory function through selective inhibition of the epigenetic reader protein SP140. Bmc Biology. 2022;20(1):182.