Anti SP110 pAb (ATL-HPA058554)

Atlas Antibodies

SKU:
ATL-HPA058554-100
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
  • Western blot analysis in human cell line RT-4.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: SP110 nuclear body protein
Gene Name: SP110
Alternative Gene Name: IFI41, IFI75
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079808: 33%, ENSRNOG00000033747: 37%
Entrez Gene ID: 3431
Uniprot ID: Q9HB58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLPALIQEGRSTSVTNDKLTSKMNAEEDSEEMPSLLTSTVQVASDNLIPQIRDKEDPQEMPHSPLGSMPEIRDNSPEPNDPE
Gene Sequence PLPALIQEGRSTSVTNDKLTSKMNAEEDSEEMPSLLTSTVQVASDNLIPQIRDKEDPQEMPHSPLGSMPEIRDNSPEPNDPE
Gene ID - Mouse ENSMUSG00000079808
Gene ID - Rat ENSRNOG00000033747
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SP110 pAb (ATL-HPA058554)
Datasheet Anti SP110 pAb (ATL-HPA058554) Datasheet (External Link)
Vendor Page Anti SP110 pAb (ATL-HPA058554) at Atlas Antibodies

Documents & Links for Anti SP110 pAb (ATL-HPA058554)
Datasheet Anti SP110 pAb (ATL-HPA058554) Datasheet (External Link)
Vendor Page Anti SP110 pAb (ATL-HPA058554)