Anti SP110 pAb (ATL-HPA058554)

Atlas Antibodies

Catalog No.: ATL-HPA058554-100

Protein Description: SP110 nuclear body protein
Gene Name: SP110
Alternative Gene Name: IFI41, IFI75
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079808: 33%, ENSRNOG00000033747: 37%
Entrez Gene ID: 3431
Uniprot ID: Q9HB58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLPALIQEGRSTSVTNDKLTSKMNAEEDSEEMPSLLTSTVQVASDNLIPQIRDKEDPQEMPHSPLGSMPEIRDNSPEPNDPE
• Gene Sequence: PLPALIQEGRSTSVTNDKLTSKMNAEEDSEEMPSLLTSTVQVASDNLIPQIRDKEDPQEMPHSPLGSMPEIRDNSPEPNDPE
• Gene ID - Mouse: ENSMUSG00000079808
• Gene ID - Rat: ENSRNOG00000033747
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.