Anti SOX8 pAb (ATL-HPA058665)

Atlas Antibodies

Catalog No.:
ATL-HPA058665-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SRY (sex determining region Y)-box 8
Gene Name: SOX8
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024176: 73%, ENSRNOG00000018841: 70%
Entrez Gene ID: 30812
Uniprot ID: P57073
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRRRKSAKAGHSDSDSGAELGPHPGGGAVYKAEAGLGDGHHHGDHTGQTH
Gene Sequence PRRRKSAKAGHSDSDSGAELGPHPGGGAVYKAEAGLGDGHHHGDHTGQTH
Gene ID - Mouse ENSMUSG00000024176
Gene ID - Rat ENSRNOG00000018841
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SOX8 pAb (ATL-HPA058665)
Datasheet Anti SOX8 pAb (ATL-HPA058665) Datasheet (External Link)
Vendor Page Anti SOX8 pAb (ATL-HPA058665) at Atlas Antibodies

Documents & Links for Anti SOX8 pAb (ATL-HPA058665)
Datasheet Anti SOX8 pAb (ATL-HPA058665) Datasheet (External Link)
Vendor Page Anti SOX8 pAb (ATL-HPA058665)