Anti SOX15 pAb (ATL-HPA074049)

Atlas Antibodies

Catalog No.:
ATL-HPA074049-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: SRY (sex determining region Y)-box 15
Gene Name: SOX15
Alternative Gene Name: SOX20, SOX26, SOX27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041287: 71%, ENSRNOG00000005927: 36%
Entrez Gene ID: 6665
Uniprot ID: O60248
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSHCKLEAPSPCSLPQSDPRLQGELLPTYTHYLPPGSPTPYNPPLAGAPMPLTHL
Gene Sequence SSHCKLEAPSPCSLPQSDPRLQGELLPTYTHYLPPGSPTPYNPPLAGAPMPLTHL
Gene ID - Mouse ENSMUSG00000041287
Gene ID - Rat ENSRNOG00000005927
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SOX15 pAb (ATL-HPA074049)
Datasheet Anti SOX15 pAb (ATL-HPA074049) Datasheet (External Link)
Vendor Page Anti SOX15 pAb (ATL-HPA074049) at Atlas Antibodies

Documents & Links for Anti SOX15 pAb (ATL-HPA074049)
Datasheet Anti SOX15 pAb (ATL-HPA074049) Datasheet (External Link)
Vendor Page Anti SOX15 pAb (ATL-HPA074049)