Anti SOX15 pAb (ATL-HPA074049)

Atlas Antibodies

Catalog No.: ATL-HPA074049-25

Protein Description: SRY (sex determining region Y)-box 15
Gene Name: SOX15
Alternative Gene Name: SOX20, SOX26, SOX27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041287: 71%, ENSRNOG00000005927: 36%
Entrez Gene ID: 6665
Uniprot ID: O60248
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSHCKLEAPSPCSLPQSDPRLQGELLPTYTHYLPPGSPTPYNPPLAGAPMPLTHL
• Gene Sequence: SSHCKLEAPSPCSLPQSDPRLQGELLPTYTHYLPPGSPTPYNPPLAGAPMPLTHL
• Gene ID - Mouse: ENSMUSG00000041287
• Gene ID - Rat: ENSRNOG00000005927
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.