Anti SOX12 pAb (ATL-HPA061627)

Atlas Antibodies

Catalog No.:
ATL-HPA061627-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: SRY (sex determining region Y)-box 12
Gene Name: SOX12
Alternative Gene Name: SOX22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051817: 91%, ENSRNOG00000007514: 91%
Entrez Gene ID: 6666
Uniprot ID: O15370
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEELLEVRLVETPGRELWRMVPAGRAARGQAE
Gene Sequence DEELLEVRLVETPGRELWRMVPAGRAARGQAE
Gene ID - Mouse ENSMUSG00000051817
Gene ID - Rat ENSRNOG00000007514
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SOX12 pAb (ATL-HPA061627)
Datasheet Anti SOX12 pAb (ATL-HPA061627) Datasheet (External Link)
Vendor Page Anti SOX12 pAb (ATL-HPA061627) at Atlas Antibodies

Documents & Links for Anti SOX12 pAb (ATL-HPA061627)
Datasheet Anti SOX12 pAb (ATL-HPA061627) Datasheet (External Link)
Vendor Page Anti SOX12 pAb (ATL-HPA061627)