Anti SOX12 pAb (ATL-HPA061627)

Atlas Antibodies

Catalog No.: ATL-HPA061627-25

Protein Description: SRY (sex determining region Y)-box 12
Gene Name: SOX12
Alternative Gene Name: SOX22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051817: 91%, ENSRNOG00000007514: 91%
Entrez Gene ID: 6666
Uniprot ID: O15370
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEELLEVRLVETPGRELWRMVPAGRAARGQAE
• Gene Sequence: DEELLEVRLVETPGRELWRMVPAGRAARGQAE
• Gene ID - Mouse: ENSMUSG00000051817
• Gene ID - Rat: ENSRNOG00000007514
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.