Anti SOX11 pAb (ATL-HPA000536)

Atlas Antibodies

Catalog No.:
ATL-HPA000536-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: SRY (sex determining region Y)-box 11
Gene Name: SOX11
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063632: 82%, ENSRNOG00000030034: 82%
Entrez Gene ID: 6664
Uniprot ID: P35716
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK
Gene Sequence FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK
Gene ID - Mouse ENSMUSG00000063632
Gene ID - Rat ENSRNOG00000030034
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SOX11 pAb (ATL-HPA000536)
Datasheet Anti SOX11 pAb (ATL-HPA000536) Datasheet (External Link)
Vendor Page Anti SOX11 pAb (ATL-HPA000536) at Atlas Antibodies

Documents & Links for Anti SOX11 pAb (ATL-HPA000536)
Datasheet Anti SOX11 pAb (ATL-HPA000536) Datasheet (External Link)
Vendor Page Anti SOX11 pAb (ATL-HPA000536)
Citations for Anti SOX11 pAb (ATL-HPA000536) – 26 Found
Wiemhoefer, Anne; Stargardt, Anita; van der Linden, Wouter A; Renner, Maria C; van Kesteren, Ronald E; Stap, Jan; Raspe, Marcel A; Tomkinson, Birgitta; Kessels, Helmut W; Ovaa, Huib; Overkleeft, Herman S; Florea, Bogdan; Reits, Eric A. Tripeptidyl Peptidase II Mediates Levels of Nuclear Phosphorylated ERK1 and ERK2. Molecular & Cellular Proteomics : Mcp. 2015;14(8):2177-93.  PubMed
Otsuka, Yasuyuki; Nishikori, Momoko; Kitano, Toshiyuki; Oka, Tomomi; Ishikawa, Takayuki; Haga, Hironori; Takaori-Kondo, Akifumi. Persistence of a t(11;14)-positive clone in a patient with mantle cell lymphoma for 20 years. Clinical Case Reports. 2017;5(4):477-481.  PubMed
Lord, Martin; Arvidsson, Gustav; Wasik, Agata M; Christensson, Birger; Wright, Anthony P; Grandien, Alf; Sander, Birgitta. Impact of Sox11 over-expression in Ba/F3 cells. Haematologica. 2018;103(12):e594-e597.  PubMed
Yang, Zhi; Jiang, Shuai; Lu, Chenxi; Ji, Ting; Yang, Wenwen; Li, Tian; Lv, Jianjun; Hu, Wei; Yang, Yang; Jin, Zhenxiao. SOX11: friend or foe in tumor prevention and carcinogenesis?. Therapeutic Advances In Medical Oncology. 11( 31210798):1758835919853449.  PubMed
Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81.  PubMed
Ek, Sara; Dictor, Michael; Jerkeman, Mats; Jirström, Karin; Borrebaeck, Carl A K. Nuclear expression of the non B-cell lineage Sox11 transcription factor identifies mantle cell lymphoma. Blood. 2008;111(2):800-5.  PubMed
Wang, Xiao; Asplund, A Charlotta; Porwit, Anna; Flygare, Jenny; Smith, C I Edvard; Christensson, Birger; Sander, Birgitta. The subcellular Sox11 distribution pattern identifies subsets of mantle cell lymphoma: correlation to overall survival. British Journal Of Haematology. 2008;143(2):248-52.  PubMed
Chen, Yi-Hua; Gao, Juehua; Fan, Guang; Peterson, LoAnn C. Nuclear expression of sox11 is highly associated with mantle cell lymphoma but is independent of t(11;14)(q13;q32) in non-mantle cell B-cell neoplasms. Modern Pathology : An Official Journal Of The United States And Canadian Academy Of Pathology, Inc. 2010;23(1):105-12.  PubMed
Mozos, Ana; Royo, Cristina; Hartmann, Elena; De Jong, Daphne; Baró, Cristina; Valera, Alexandra; Fu, Kai; Weisenburger, Dennis D; Delabie, Jan; Chuang, Shih-Sung; Jaffe, Elaine S; Ruiz-Marcellan, Carmen; Dave, Sandeep; Rimsza, Lisa; Braziel, Rita; Gascoyne, Randy D; Solé, Francisco; López-Guillermo, Armando; Colomer, Dolors; Staudt, Louis M; Rosenwald, Andreas; Ott, German; Jares, Pedro; Campo, Elias. SOX11 expression is highly specific for mantle cell lymphoma and identifies the cyclin D1-negative subtype. Haematologica. 2009;94(11):1555-62.  PubMed
Dictor, Michael; Ek, Sara; Sundberg, Maria; Warenholt, Janina; György, Czabafy; Sernbo, Sandra; Gustavsson, Elin; Abu-Alsoud, Waleed; Wadström, Torkel; Borrebaeck, Carl. Strong lymphoid nuclear expression of SOX11 transcription factor defines lymphoblastic neoplasms, mantle cell lymphoma and Burkitt's lymphoma. Haematologica. 2009;94(11):1563-8.  PubMed
Fernàndez, Verònica; Salamero, Olga; Espinet, Blanca; Solé, Francesc; Royo, Cristina; Navarro, Alba; Camacho, Francisca; Beà, Sílvia; Hartmann, Elena; Amador, Virginia; Hernández, Luis; Agostinelli, Claudio; Sargent, Rachel L; Rozman, Maria; Aymerich, Marta; Colomer, Dolors; Villamor, Neus; Swerdlow, Steven H; Pileri, Stefano A; Bosch, Francesc; Piris, Miguel A; Montserrat, Emili; Ott, German; Rosenwald, Andreas; López-Guillermo, Armando; Jares, Pedro; Serrano, Sergi; Campo, Elías. Genomic and gene expression profiling defines indolent forms of mantle cell lymphoma. Cancer Research. 2010;70(4):1408-18.  PubMed
Aiden, Aviva Presser; Rivera, Miguel N; Rheinbay, Esther; Ku, Manching; Coffman, Erik J; Truong, Thanh T; Vargas, Sara O; Lander, Eric S; Haber, Daniel A; Bernstein, Bradley E. Wilms tumor chromatin profiles highlight stem cell properties and a renal developmental network. Cell Stem Cell. 2010;6(6):591-602.  PubMed
Gustavsson, Elin; Sernbo, Sandra; Andersson, Elin; Brennan, Donal J; Dictor, Michael; Jerkeman, Mats; Borrebaeck, Carl Ak; Ek, Sara. SOX11 expression correlates to promoter methylation and regulates tumor growth in hematopoietic malignancies. Molecular Cancer. 2010;9( 20624318):187.  PubMed
Wang, Xiao; Björklund, Stefan; Wasik, Agata M; Grandien, Alf; Andersson, Patrik; Kimby, Eva; Dahlman-Wright, Karin; Zhao, Chunyan; Christensson, Birger; Sander, Birgitta. Gene expression profiling and chromatin immunoprecipitation identify DBN1, SETMAR and HIG2 as direct targets of SOX11 in mantle cell lymphoma. Plos One. 2010;5(11):e14085.  PubMed
Cao, Xin; Fan, Lei; Fang, Cheng; Zhu, Dan-Xia; Dong, Hua-Jie; Wang, Dong-Mei; Wang, Yin-Hua; Xu, Wei; Li, Jian-Yong. The expression of SOX11, cyclin D1, cyclin D2, and cyclin D3 in B-cell lymphocytic proliferative diseases. Medical Oncology (Northwood, London, England). 2012;29(2):1190-6.  PubMed
Ondrejka, Sarah L; Lai, Raymond; Smith, Stephen D; Hsi, Eric D. Indolent mantle cell leukemia: a clinicopathological variant characterized by isolated lymphocytosis, interstitial bone marrow involvement, kappa light chain restriction, and good prognosis. Haematologica. 2011;96(8):1121-7.  PubMed
Kimura, Yoshizo; Sato, Kensaku; Imamura, Yutaka; Arakawa, Fumiko; Kiyasu, Junichi; Takeuchi, Masanori; Miyoshi, Hiroaki; Yoshida, Maki; Niino, Daisuke; Sugita, Yasuo; Morito, Toshiaki; Yoshino, Tadashi; Nakamura, Shigeo; Ohshima, Koichi. Small cell variant of mantle cell lymphoma is an indolent lymphoma characterized by bone marrow involvement, splenomegaly, and a low Ki-67 index. Cancer Science. 2011;102(9):1734-41.  PubMed
Sernbo, Sandra; Gustavsson, Elin; Brennan, Donal J; Gallagher, William M; Rexhepaj, Elton; Rydnert, Frida; Jirström, Karin; Borrebaeck, Carl Ak; Ek, Sara. The tumour suppressor SOX11 is associated with improved survival among high grade epithelial ovarian cancers and is regulated by reversible promoter methylation. Bmc Cancer. 2011;11( 21943380):405.  PubMed
Carvajal-Cuenca, Alejandra; Sua, Luz F; Silva, Nhora M; Pittaluga, Stefania; Royo, Cristina; Song, Joo Y; Sargent, Rachel L; Espinet, Blanca; Climent, Fina; Jacobs, Samuel A; Delabie, Jan; Naresh, Kikkeri N; Bagg, Adam; Brousset, Pierre; Warnke, Roger A; Serrano, Sergi; Harris, Nancy Lee; Swerdlow, Steven H; Jaffe, Elaine S; Campo, Elías. In situ mantle cell lymphoma: clinical implications of an incidental finding with indolent clinical behavior. Haematologica. 2012;97(2):270-8.  PubMed
Nygren, Lina; Baumgartner Wennerholm, Stefanie; Klimkowska, Monika; Christensson, Birger; Kimby, Eva; Sander, Birgitta. Prognostic role of SOX11 in a population-based cohort of mantle cell lymphoma. Blood. 2012;119(18):4215-23.  PubMed
Kuo, P-Y; Leshchenko, V V; Fazzari, M J; Perumal, D; Gellen, T; He, T; Iqbal, J; Baumgartner-Wennerholm, S; Nygren, L; Zhang, F; Zhang, W; Suh, K S; Goy, A; Yang, D T; Chan, W-C; Kahl, B S; Verma, A K; Gascoyne, R D; Kimby, E; Sander, B; Ye, B H; Melnick, A M; Parekh, S. High-resolution chromatin immunoprecipitation (ChIP) sequencing reveals novel binding targets and prognostic role for SOX11 in mantle cell lymphoma. Oncogene. 2015;34(10):1231-40.  PubMed
Davidson, Ben; Holth, Arild; Hellesylt, Ellen; Tan, Tuan Zea; Huang, Ruby Yun-Ju; Tropé, Claes; Nesland, Jahn M; Thiery, Jean Paul. The clinical role of epithelial-mesenchymal transition and stem cell markers in advanced-stage ovarian serous carcinoma effusions. Human Pathology. 2015;46(1):1-8.  PubMed
Miao, Qi; Hill, Matthew C; Chen, Fengju; Mo, Qianxing; Ku, Amy T; Ramos, Carlos; Sock, Elisabeth; Lefebvre, Véronique; Nguyen, Hoang. SOX11 and SOX4 drive the reactivation of an embryonic gene program during murine wound repair. Nature Communications. 2019;10(1):4042.  PubMed
Lee, Woojoo; Shin, Eun; Kim, Bo-Hyung; Kim, Hyunchul. Diagnostic accuracy of SOX11 immunohistochemistry in mantle cell lymphoma: A meta-analysis. Plos One. 14(11):e0225096.  PubMed
Grönroos, Toni; Mäkinen, Artturi; Laukkanen, Saara; Mehtonen, Juha; Nikkilä, Atte; Oksa, Laura; Rounioja, Samuli; Marincevic-Zuniga, Yanara; Nordlund, Jessica; Pohjolainen, Virva; Paavonen, Timo; Heinäniemi, Merja; Lohi, Olli. Clinicopathological features and prognostic value of SOX11 in childhood acute lymphoblastic leukemia. Scientific Reports. 2020;10(1):2043.  PubMed
Decaesteker, Bieke; Louwagie, Amber; Loontiens, Siebe; De Vloed, Fanny; Bekaert, Sarah-Lee; Roels, Juliette; Vanhauwaert, Suzanne; De Brouwer, Sara; Sanders, Ellen; Berezovskaya, Alla; Denecker, Geertrui; D'haene, Eva; Van Haver, Stéphane; Van Loocke, Wouter; Van Dorpe, Jo; Creytens, David; Van Roy, Nadine; Pieters, Tim; Van Neste, Christophe; Fischer, Matthias; Van Vlierberghe, Pieter; Roberts, Stephen S; Schulte, Johannes; Ek, Sara; Versteeg, Rogier; Koster, Jan; van Nes, Johan; Zimmerman, Mark; De Preter, Katleen; Speleman, Frank. SOX11 regulates SWI/SNF complex components as member of the adrenergic neuroblastoma core regulatory circuitry. Nature Communications. 2023;14(1):1267.  PubMed