Anti SOS2 pAb (ATL-HPA052689)

Atlas Antibodies

Catalog No.:
ATL-HPA052689-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: son of sevenless homolog 2 (Drosophila)
Gene Name: SOS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034801: 92%, ENSRNOG00000004826: 92%
Entrez Gene ID: 6655
Uniprot ID: Q07890
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPVPLRPPEHFINCPFNLQPPPLGHLHRDSDWLRDISTCPNSPSTPPST
Gene Sequence PPVPLRPPEHFINCPFNLQPPPLGHLHRDSDWLRDISTCPNSPSTPPST
Gene ID - Mouse ENSMUSG00000034801
Gene ID - Rat ENSRNOG00000004826
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SOS2 pAb (ATL-HPA052689)
Datasheet Anti SOS2 pAb (ATL-HPA052689) Datasheet (External Link)
Vendor Page Anti SOS2 pAb (ATL-HPA052689) at Atlas Antibodies

Documents & Links for Anti SOS2 pAb (ATL-HPA052689)
Datasheet Anti SOS2 pAb (ATL-HPA052689) Datasheet (External Link)
Vendor Page Anti SOS2 pAb (ATL-HPA052689)