Anti SOCS4 pAb (ATL-HPA057961)

Atlas Antibodies

SKU:
ATL-HPA057961-25
  • Immunofluorescent staining of human cell line A549 shows localization to nucleus & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: suppressor of cytokine signaling 4
Gene Name: SOCS4
Alternative Gene Name: SOCS7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048379: 80%, ENSRNOG00000011377: 78%
Entrez Gene ID: 122809
Uniprot ID: Q8WXH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GYVWSGKKLSWSKKSESYSDAETVNGIEKTEVSLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSS
Gene Sequence GYVWSGKKLSWSKKSESYSDAETVNGIEKTEVSLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSS
Gene ID - Mouse ENSMUSG00000048379
Gene ID - Rat ENSRNOG00000011377
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SOCS4 pAb (ATL-HPA057961)
Datasheet Anti SOCS4 pAb (ATL-HPA057961) Datasheet (External Link)
Vendor Page Anti SOCS4 pAb (ATL-HPA057961) at Atlas Antibodies

Documents & Links for Anti SOCS4 pAb (ATL-HPA057961)
Datasheet Anti SOCS4 pAb (ATL-HPA057961) Datasheet (External Link)
Vendor Page Anti SOCS4 pAb (ATL-HPA057961)