Anti SOCS1 pAb (ATL-HPA074108)

Atlas Antibodies

Catalog No.:
ATL-HPA074108-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: suppressor of cytokine signaling 1
Gene Name: SOCS1
Alternative Gene Name: Cish1, JAB, SOCS-1, SSI-1, TIP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038037: 97%, ENSRNOG00000002568: 97%
Entrez Gene ID: 8651
Uniprot ID: O15524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
Gene Sequence LQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
Gene ID - Mouse ENSMUSG00000038037
Gene ID - Rat ENSRNOG00000002568
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SOCS1 pAb (ATL-HPA074108)
Datasheet Anti SOCS1 pAb (ATL-HPA074108) Datasheet (External Link)
Vendor Page Anti SOCS1 pAb (ATL-HPA074108) at Atlas Antibodies

Documents & Links for Anti SOCS1 pAb (ATL-HPA074108)
Datasheet Anti SOCS1 pAb (ATL-HPA074108) Datasheet (External Link)
Vendor Page Anti SOCS1 pAb (ATL-HPA074108)