Anti SOCS1 pAb (ATL-HPA074108)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074108-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SOCS1
Alternative Gene Name: Cish1, JAB, SOCS-1, SSI-1, TIP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038037: 97%, ENSRNOG00000002568: 97%
Entrez Gene ID: 8651
Uniprot ID: O15524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI |
| Gene Sequence | LQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI |
| Gene ID - Mouse | ENSMUSG00000038037 |
| Gene ID - Rat | ENSRNOG00000002568 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SOCS1 pAb (ATL-HPA074108) | |
| Datasheet | Anti SOCS1 pAb (ATL-HPA074108) Datasheet (External Link) |
| Vendor Page | Anti SOCS1 pAb (ATL-HPA074108) at Atlas Antibodies |
| Documents & Links for Anti SOCS1 pAb (ATL-HPA074108) | |
| Datasheet | Anti SOCS1 pAb (ATL-HPA074108) Datasheet (External Link) |
| Vendor Page | Anti SOCS1 pAb (ATL-HPA074108) |