Anti SOBP pAb (ATL-HPA029242)

Atlas Antibodies

Catalog No.: ATL-HPA029242-25

Protein Description: sine oculis binding protein homolog (Drosophila)
Gene Name: SOBP
Alternative Gene Name: FLJ10159
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038248: 96%, ENSRNOG00000000316: 96%
Entrez Gene ID: 55084
Uniprot ID: A7XYQ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVPIIVPLIPPPFIKPPAEDDVSNVQIMCAWCQKVGIKRYSLSMGSEVKSFCSEKCFAACRRAYFKRNKARDEDGHAENFPQQH
• Gene Sequence: SVPIIVPLIPPPFIKPPAEDDVSNVQIMCAWCQKVGIKRYSLSMGSEVKSFCSEKCFAACRRAYFKRNKARDEDGHAENFPQQH
• Gene ID - Mouse: ENSMUSG00000038248
• Gene ID - Rat: ENSRNOG00000000316
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.