Anti SNX9 pAb (ATL-HPA057203)
Atlas Antibodies
- SKU:
- ATL-HPA057203-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SNX9
Alternative Gene Name: SDP1, SH3PX1, SH3PXD3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002365: 89%, ENSRNOG00000046874: 91%
Entrez Gene ID: 51429
Uniprot ID: Q9Y5X1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVA |
Gene Sequence | RVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVA |
Gene ID - Mouse | ENSMUSG00000002365 |
Gene ID - Rat | ENSRNOG00000046874 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SNX9 pAb (ATL-HPA057203) | |
Datasheet | Anti SNX9 pAb (ATL-HPA057203) Datasheet (External Link) |
Vendor Page | Anti SNX9 pAb (ATL-HPA057203) at Atlas Antibodies |
Documents & Links for Anti SNX9 pAb (ATL-HPA057203) | |
Datasheet | Anti SNX9 pAb (ATL-HPA057203) Datasheet (External Link) |
Vendor Page | Anti SNX9 pAb (ATL-HPA057203) |