Anti SNX9 pAb (ATL-HPA031410 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031410-25

Protein Description: sorting nexin 9
Gene Name: SNX9
Alternative Gene Name: SDP1, SH3PX1, SH3PXD3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002365: 88%, ENSRNOG00000046874: 62%
Entrez Gene ID: 51429
Uniprot ID: Q9Y5X1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMW
• Gene Sequence: YQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMW
• Gene ID - Mouse: ENSMUSG00000002365
• Gene ID - Rat: ENSRNOG00000046874
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SNX9 pAb (ATL-HPA031410 w/enhanced validation) – 9 Found

Bendris, Nawal; Williams, Karla C; Reis, Carlos R; Welf, Erik S; Chen, Ping-Hung; Lemmers, Bénédicte; Hahne, Michael; Leong, H S; Schmid, Sandra L. SNX9 promotes metastasis by enhancing cancer cell invasion via differential regulation of RhoGTPases. Molecular Biology Of The Cell. 2016;27(9):1409-19. 

Liu, Chengcheng; Zhai, Xiaoyan; Du, Haibo; Cao, Yujie; Cao, Huiren; Wang, Yanfei; Yu, Xiao; Gao, Jiangang; Xu, Zhigang. Sorting nexin 9 (SNX9) is not essential for development and auditory function in mice. Oncotarget. 2016;7(42):68921-68932. 

Tanigawa, Kazufumi; Maekawa, Masashi; Kiyoi, Takeshi; Nakayama, Jun; Kitazawa, Riko; Kitazawa, Sohei; Semba, Kentaro; Taguchi, Tomohiko; Akita, Satoshi; Yoshida, Motohira; Ishimaru, Kei; Watanabe, Yuji; Higashiyama, Shigeki. SNX9 determines the surface levels of integrin β1 in vascular endothelial cells: Implication in poor prognosis of human colorectal cancers overexpressing SNX9. Journal Of Cellular Physiology. 2019;234(10):17280-17294. 

Carim, Sabrya C; Ben El Kadhi, Khaled; Yan, Guanhua; Sweeney, Sean T; Hickson, Gilles R; Carréno, Sébastien; Lowe, Martin. IPIP27 Coordinates PtdIns(4,5)P(2) Homeostasis for Successful Cytokinesis. Current Biology : Cb. 2019;29(5):775-789.e7. 

Wrobel, Antoni G; Kadlecova, Zuzana; Kamenicky, Jan; Yang, Ji-Chun; Herrmann, Torsten; Kelly, Bernard T; McCoy, Airlie J; Evans, Philip R; Martin, Stephen; Müller, Stefan; Salomon, Susanne; Sroubek, Filip; Neuhaus, David; Höning, Stefan; Owen, David J. Temporal Ordering in Endocytic Clathrin-Coated Vesicle Formation via AP2 Phosphorylation. Developmental Cell. 2019;50(4):494-508.e11. 

Bendris, Nawal; Stearns, Carrie J S; Reis, Carlos R; Rodriguez-Canales, Jaime; Liu, Hui; Witkiewicz, Agnieszka W; Schmid, Sandra L. Sorting nexin 9 negatively regulates invadopodia formation and function in cancer cells. Journal Of Cell Science. 2016;129(14):2804-16. 

Echarri, Asier; Pavón, Dácil M; Sánchez, Sara; García-García, María; Calvo, Enrique; Huerta-López, Carla; Velázquez-Carreras, Diana; Viaris de Lesegno, Christine; Ariotti, Nicholas; Lázaro-Carrillo, Ana; Strippoli, Raffaele; De Sancho, David; Alegre-Cebollada, Jorge; Lamaze, Christophe; Parton, Robert G; Del Pozo, Miguel A. An Abl-FBP17 mechanosensing system couples local plasma membrane curvature and stress fiber remodeling during mechanoadaptation. Nature Communications. 2019;10(1):5828. 

Wang, Xinxin; Chen, Zhiming; Mettlen, Marcel; Noh, Jungsik; Schmid, Sandra L; Danuser, Gaudenz. DASC, a sensitive classifier for measuring discrete early stages in clathrin-mediated endocytosis. Elife. 2020;9( 32352376) 

Feng, Zhen; Yu, Cheng-Han. PI(3,4)P(2)-mediated membrane tubulation promotes integrin trafficking and invasive cell migration. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2021;118(19)