Anti SNX7 pAb (ATL-HPA054338)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054338-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SNX7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028007: 87%, ENSRNOG00000017077: 91%
Entrez Gene ID: 51375
Uniprot ID: Q9UNH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IHILWSASEEDLVDTLKDVASCIDRCCKATEKRMSGLSEALLPVVHEYVLYSEMLMGVMKRRDQIQAELDSKVEV |
Gene Sequence | IHILWSASEEDLVDTLKDVASCIDRCCKATEKRMSGLSEALLPVVHEYVLYSEMLMGVMKRRDQIQAELDSKVEV |
Gene ID - Mouse | ENSMUSG00000028007 |
Gene ID - Rat | ENSRNOG00000017077 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SNX7 pAb (ATL-HPA054338) | |
Datasheet | Anti SNX7 pAb (ATL-HPA054338) Datasheet (External Link) |
Vendor Page | Anti SNX7 pAb (ATL-HPA054338) at Atlas Antibodies |
Documents & Links for Anti SNX7 pAb (ATL-HPA054338) | |
Datasheet | Anti SNX7 pAb (ATL-HPA054338) Datasheet (External Link) |
Vendor Page | Anti SNX7 pAb (ATL-HPA054338) |