Anti SNX6 pAb (ATL-HPA049374)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049374-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SNX6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005656: 89%, ENSRNOG00000005249: 87%
Entrez Gene ID: 58533
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RLGAAMMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSE |
| Gene Sequence | RLGAAMMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSE |
| Gene ID - Mouse | ENSMUSG00000005656 |
| Gene ID - Rat | ENSRNOG00000005249 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SNX6 pAb (ATL-HPA049374) | |
| Datasheet | Anti SNX6 pAb (ATL-HPA049374) Datasheet (External Link) |
| Vendor Page | Anti SNX6 pAb (ATL-HPA049374) at Atlas Antibodies |
| Documents & Links for Anti SNX6 pAb (ATL-HPA049374) | |
| Datasheet | Anti SNX6 pAb (ATL-HPA049374) Datasheet (External Link) |
| Vendor Page | Anti SNX6 pAb (ATL-HPA049374) |