Anti SNX6 pAb (ATL-HPA049374)
Atlas Antibodies
- SKU:
- ATL-HPA049374-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SNX6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005656: 89%, ENSRNOG00000005249: 87%
Entrez Gene ID: 58533
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RLGAAMMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSE |
Gene Sequence | RLGAAMMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSE |
Gene ID - Mouse | ENSMUSG00000005656 |
Gene ID - Rat | ENSRNOG00000005249 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SNX6 pAb (ATL-HPA049374) | |
Datasheet | Anti SNX6 pAb (ATL-HPA049374) Datasheet (External Link) |
Vendor Page | Anti SNX6 pAb (ATL-HPA049374) at Atlas Antibodies |
Documents & Links for Anti SNX6 pAb (ATL-HPA049374) | |
Datasheet | Anti SNX6 pAb (ATL-HPA049374) Datasheet (External Link) |
Vendor Page | Anti SNX6 pAb (ATL-HPA049374) |