Anti SNX6 pAb (ATL-HPA049374)

Atlas Antibodies

Catalog No.:
ATL-HPA049374-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: sorting nexin 6
Gene Name: SNX6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005656: 89%, ENSRNOG00000005249: 87%
Entrez Gene ID: 58533
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLGAAMMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSE
Gene Sequence RLGAAMMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSE
Gene ID - Mouse ENSMUSG00000005656
Gene ID - Rat ENSRNOG00000005249
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SNX6 pAb (ATL-HPA049374)
Datasheet Anti SNX6 pAb (ATL-HPA049374) Datasheet (External Link)
Vendor Page Anti SNX6 pAb (ATL-HPA049374) at Atlas Antibodies

Documents & Links for Anti SNX6 pAb (ATL-HPA049374)
Datasheet Anti SNX6 pAb (ATL-HPA049374) Datasheet (External Link)
Vendor Page Anti SNX6 pAb (ATL-HPA049374)