Anti SNX5 pAb (ATL-HPA076450)

Atlas Antibodies

Catalog No.:
ATL-HPA076450-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: sorting nexin 5
Gene Name: SNX5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027423: 90%, ENSRNOG00000006077: 90%
Entrez Gene ID: 27131
Uniprot ID: Q9Y5X3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVVVPELLQQQEEDRSKLRSVSVDLNVDPSL
Gene Sequence MVVVPELLQQQEEDRSKLRSVSVDLNVDPSL
Gene ID - Mouse ENSMUSG00000027423
Gene ID - Rat ENSRNOG00000006077
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SNX5 pAb (ATL-HPA076450)
Datasheet Anti SNX5 pAb (ATL-HPA076450) Datasheet (External Link)
Vendor Page Anti SNX5 pAb (ATL-HPA076450) at Atlas Antibodies

Documents & Links for Anti SNX5 pAb (ATL-HPA076450)
Datasheet Anti SNX5 pAb (ATL-HPA076450) Datasheet (External Link)
Vendor Page Anti SNX5 pAb (ATL-HPA076450)