Anti SNX24 pAb (ATL-HPA073934)

Atlas Antibodies

Catalog No.:
ATL-HPA073934-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: sorting nexin 24
Gene Name: SNX24
Alternative Gene Name: SBBI31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024535: 95%, ENSRNOG00000017488: 95%
Entrez Gene ID: 28966
Uniprot ID: Q9Y343
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHA
Gene Sequence MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHA
Gene ID - Mouse ENSMUSG00000024535
Gene ID - Rat ENSRNOG00000017488
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SNX24 pAb (ATL-HPA073934)
Datasheet Anti SNX24 pAb (ATL-HPA073934) Datasheet (External Link)
Vendor Page Anti SNX24 pAb (ATL-HPA073934) at Atlas Antibodies

Documents & Links for Anti SNX24 pAb (ATL-HPA073934)
Datasheet Anti SNX24 pAb (ATL-HPA073934) Datasheet (External Link)
Vendor Page Anti SNX24 pAb (ATL-HPA073934)