Anti SNX16 pAb (ATL-HPA024730)

Atlas Antibodies

Catalog No.: ATL-HPA024730-25

Protein Description: sorting nexin 16
Gene Name: SNX16
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027534: 96%, ENSRNOG00000009953: 97%
Entrez Gene ID: 64089
Uniprot ID: P57768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESL
• Gene Sequence: FPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESL
• Gene ID - Mouse: ENSMUSG00000027534
• Gene ID - Rat: ENSRNOG00000009953
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.