Anti SNX16 pAb (ATL-HPA024730)

Atlas Antibodies

Catalog No.:
ATL-HPA024730-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: sorting nexin 16
Gene Name: SNX16
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027534: 96%, ENSRNOG00000009953: 97%
Entrez Gene ID: 64089
Uniprot ID: P57768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen FPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESL
Gene Sequence FPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESL
Gene ID - Mouse ENSMUSG00000027534
Gene ID - Rat ENSRNOG00000009953
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SNX16 pAb (ATL-HPA024730)
Datasheet Anti SNX16 pAb (ATL-HPA024730) Datasheet (External Link)
Vendor Page Anti SNX16 pAb (ATL-HPA024730) at Atlas Antibodies

Documents & Links for Anti SNX16 pAb (ATL-HPA024730)
Datasheet Anti SNX16 pAb (ATL-HPA024730) Datasheet (External Link)
Vendor Page Anti SNX16 pAb (ATL-HPA024730)