Anti SNX16 pAb (ATL-HPA024730)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024730-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SNX16
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027534: 96%, ENSRNOG00000009953: 97%
Entrez Gene ID: 64089
Uniprot ID: P57768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESL |
Gene Sequence | FPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESL |
Gene ID - Mouse | ENSMUSG00000027534 |
Gene ID - Rat | ENSRNOG00000009953 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SNX16 pAb (ATL-HPA024730) | |
Datasheet | Anti SNX16 pAb (ATL-HPA024730) Datasheet (External Link) |
Vendor Page | Anti SNX16 pAb (ATL-HPA024730) at Atlas Antibodies |
Documents & Links for Anti SNX16 pAb (ATL-HPA024730) | |
Datasheet | Anti SNX16 pAb (ATL-HPA024730) Datasheet (External Link) |
Vendor Page | Anti SNX16 pAb (ATL-HPA024730) |