Anti SNW1 pAb (ATL-HPA002457)

Atlas Antibodies

Catalog No.: ATL-HPA002457-25

Protein Description: SNW domain containing 1
Gene Name: SNW1
Alternative Gene Name: Bx42, NCoA-62, Prp45, PRPF45, SKIIP, SKIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021039: 99%, ENSRNOG00000037998: 98%
Entrez Gene ID: 22938
Uniprot ID: Q13573
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKF
• Gene Sequence: RNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKF
• Gene ID - Mouse: ENSMUSG00000021039
• Gene ID - Rat: ENSRNOG00000037998
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SNW1 pAb (ATL-HPA002457) – 2 Found

Höflmayer, Doris; Willich, Carla; Hube-Magg, Claudia; Simon, Ronald; Lang, Dagmar; Neubauer, Emily; Jacobsen, Frank; Hinsch, Andrea; Luebke, Andreas M; Tsourlakis, Marie Christina; Huland, Hartwig; Graefen, Markus; Haese, Alexander; Heinzer, Hans; Minner, Sarah; Büscheck, Franziska; Sauter, Guido; Schlomm, Thorsten; Steurer, Stefan; Clauditz, Till S; Burandt, Eike; Wilczak, Waldemar; Bernreuther, Christian. SNW1 is a prognostic biomarker in prostate cancer. Diagnostic Pathology. 2019;14(1):33. 

Lackner, Daniel H; Durocher, Daniel; Karlseder, Jan. A siRNA-based screen for genes involved in chromosome end protection. Plos One. 6(6):e21407.