Anti SNURF pAb (ATL-HPA065733)

Atlas Antibodies

Catalog No.:
ATL-HPA065733-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SNRPN upstream reading frame
Gene Name: SNURF
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102627: 97%, ENSRNOG00000054391: 94%
Entrez Gene ID: 8926
Uniprot ID: Q9Y675
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRRTTEQHVPEVEVQVKRRRTASLSNQECQLYPRRS
Gene Sequence LRRTTEQHVPEVEVQVKRRRTASLSNQECQLYPRRS
Gene ID - Mouse ENSMUSG00000102627
Gene ID - Rat ENSRNOG00000054391
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SNURF pAb (ATL-HPA065733)
Datasheet Anti SNURF pAb (ATL-HPA065733) Datasheet (External Link)
Vendor Page Anti SNURF pAb (ATL-HPA065733) at Atlas Antibodies

Documents & Links for Anti SNURF pAb (ATL-HPA065733)
Datasheet Anti SNURF pAb (ATL-HPA065733) Datasheet (External Link)
Vendor Page Anti SNURF pAb (ATL-HPA065733)