Anti SNTG2 pAb (ATL-HPA065258)
Atlas Antibodies
- SKU:
- ATL-HPA065258-25
- Shipping:
- Calculated at Checkout
$447.00
On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.
Gene Name: SNTG2
Alternative Gene Name: G2SYN, SYN5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020672: 77%, ENSRNOG00000004928: 76%
Entrez Gene ID: 54221
Uniprot ID: Q9NY99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ILRFYTAQDGTDWLRAVSANIRELTLQNMKMANKCCSPSDQVVHMGWVNEKLQGADSSQTFRPKFLALK |
Gene Sequence | ILRFYTAQDGTDWLRAVSANIRELTLQNMKMANKCCSPSDQVVHMGWVNEKLQGADSSQTFRPKFLALK |
Gene ID - Mouse | ENSMUSG00000020672 |
Gene ID - Rat | ENSRNOG00000004928 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SNTG2 pAb (ATL-HPA065258) | |
Datasheet | Anti SNTG2 pAb (ATL-HPA065258) Datasheet (External Link) |
Vendor Page | Anti SNTG2 pAb (ATL-HPA065258) at Atlas Antibodies |
Documents & Links for Anti SNTG2 pAb (ATL-HPA065258) | |
Datasheet | Anti SNTG2 pAb (ATL-HPA065258) Datasheet (External Link) |
Vendor Page | Anti SNTG2 pAb (ATL-HPA065258) |