Anti SNRPG pAb (ATL-HPA064152)

Atlas Antibodies

Catalog No.:
ATL-HPA064152-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: small nuclear ribonucleoprotein polypeptide G
Gene Name: SNRPG
Alternative Gene Name: Sm-G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049124: 100%, ENSRNOG00000032232: 100%
Entrez Gene ID: 6637
Uniprot ID: P62308
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RHVQGILRGFDPFMNLVIDECVEMATSGQQ
Gene Sequence RHVQGILRGFDPFMNLVIDECVEMATSGQQ
Gene ID - Mouse ENSMUSG00000049124
Gene ID - Rat ENSRNOG00000032232
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SNRPG pAb (ATL-HPA064152)
Datasheet Anti SNRPG pAb (ATL-HPA064152) Datasheet (External Link)
Vendor Page Anti SNRPG pAb (ATL-HPA064152) at Atlas Antibodies

Documents & Links for Anti SNRPG pAb (ATL-HPA064152)
Datasheet Anti SNRPG pAb (ATL-HPA064152) Datasheet (External Link)
Vendor Page Anti SNRPG pAb (ATL-HPA064152)