Anti SNRPB2 pAb (ATL-HPA076104)

Atlas Antibodies

Catalog No.:
ATL-HPA076104-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: small nuclear ribonucleoprotein polypeptide B2
Gene Name: SNRPB2
Alternative Gene Name: Msl1, U2B''
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008333: 88%, ENSRNOG00000004967: 90%
Entrez Gene ID: 6629
Uniprot ID: P08579
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQ
Gene Sequence AKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQ
Gene ID - Mouse ENSMUSG00000008333
Gene ID - Rat ENSRNOG00000004967
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SNRPB2 pAb (ATL-HPA076104)
Datasheet Anti SNRPB2 pAb (ATL-HPA076104) Datasheet (External Link)
Vendor Page Anti SNRPB2 pAb (ATL-HPA076104) at Atlas Antibodies

Documents & Links for Anti SNRPB2 pAb (ATL-HPA076104)
Datasheet Anti SNRPB2 pAb (ATL-HPA076104) Datasheet (External Link)
Vendor Page Anti SNRPB2 pAb (ATL-HPA076104)