Anti SNRPB2 pAb (ATL-HPA050814)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050814-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SNRPB2
Alternative Gene Name: Msl1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008333: 78%, ENSRNOG00000004967: 83%
Entrez Gene ID: 6629
Uniprot ID: P08579
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYI |
| Gene Sequence | TVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYI |
| Gene ID - Mouse | ENSMUSG00000008333 |
| Gene ID - Rat | ENSRNOG00000004967 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SNRPB2 pAb (ATL-HPA050814) | |
| Datasheet | Anti SNRPB2 pAb (ATL-HPA050814) Datasheet (External Link) |
| Vendor Page | Anti SNRPB2 pAb (ATL-HPA050814) at Atlas Antibodies |
| Documents & Links for Anti SNRPB2 pAb (ATL-HPA050814) | |
| Datasheet | Anti SNRPB2 pAb (ATL-HPA050814) Datasheet (External Link) |
| Vendor Page | Anti SNRPB2 pAb (ATL-HPA050814) |